| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Leukotriene B4 receptor 2 |
|---|
| Ligand | BDBM50001610 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 137±n/a nM |
|---|
| Comments | PDSP_500 |
|---|
| Citation |  Jackson, RH; Morrissey, MM; Sills, MA; Jarvis, MF Comparison of antagonist and agonist binding to the leukotriene B4 receptor intact human polymorphonuclear neutrophils (PMN). J Pharmacol Exp Ther262:80-9 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Leukotriene B4 receptor 2 |
|---|
| Name: | Leukotriene B4 receptor 2 |
|---|
| Synonyms: | BLT2R | BLTR2 | LT4R2_HUMAN | LTB4 receptor JULF2 | LTB4-R 2 | LTB4-R2 | LTB4R2 | LTB4R2 protein | Leukotriene B4 | Leukotriene B4 R2 | Leukotriene B4 receptor | Leukotriene B4 receptor 2 | Leukotriene B4 receptor BLT2 | Leukotriene b1 | Seven transmembrane receptor BLTR2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 37964.86 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Leukotriene 2 0 HUMAN::Q9NPC1 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPARGRPLAATL
VLHLALADGAVLLLTPLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASVLLTGLLSLQRC
LAVTRPFLAPRLRSPALARRLLLAVWLAALLLAVPAAVYRHLWRDRVCQLCHPSPVHAAA
HLSLETLTAFVLPFGLMLGCYSVTLARLRGARWGSGRHGARVGRLVSAIVLAFGLLWAPY
HAVNLLQAVAALAPPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG
PRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
|
|
|
|---|
| BDBM50001610 |
|---|
| n/a |
|---|
| Name | BDBM50001610 |
|---|
| Synonyms: | 7-[3-(4-Acetyl-3-methoxy-2-propyl-phenoxy)-propoxy]-8-propyl-chroman-2-carboxylic acid | 7-[3-(4-Acetyl-3-methoxy-2-propyl-phenoxy)-propoxy]-8-propyl-chroman-2-carboxylic acid (SC41930) | CGS 24115 | CHEMBL14823 | SC-41930 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H36O7 |
|---|
| Mol. Mass. | 484.5812 |
|---|
| SMILES | CCCc1c(OCCCOc2ccc3CCC(Oc3c2CCC)C(O)=O)ccc(C(C)=O)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
