| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Pituitary adenylate cyclase-activating polypeptide |
|---|
| Ligand | BDBM81524 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 10±n/a nM |
|---|
| Comments | PDSP_2358 |
|---|
| Citation |  Robberecht, P; Gourlet, P; De Neef, P; Woussen-Colle, MC; Vandermeers-Piret, MC; Vandermeers, A; Christophe, J Structural requirements for the occupancy of pituitary adenylate-cyclase-activating-peptide (PACAP) receptors and adenylate cyclase activation in human neuroblastoma NB-OK-1 cell membranes. Discovery of PACAP(6-38) as a potent antagonist. Eur J Biochem207:239-46 (1992) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Pituitary adenylate cyclase-activating polypeptide |
|---|
| Name: | Pituitary adenylate cyclase-activating polypeptide |
|---|
| Synonyms: | ADCYAP1 | PACAP | PACA_HUMAN | Pituitary adenylate cyclase-activating polypeptide |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 18847.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | PACAP 0 HUMAN::P18509 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPG
AGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGG
AGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
|
|
|
|---|
| BDBM81524 |
|---|
| n/a |
|---|
| Name | BDBM81524 |
|---|
| Synonyms: | [Phe2]PACAP(1-38) |
|---|
| Type | Small molecule |
|---|
| Emp. Form. | C209H335N63O52S |
|---|
| Mol. Mass. | 4594.352 |
|---|
| SMILES | n/a |
|---|
| Structure | 
|
|---|
Search and Browse
