Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 receptor
LigandBDBM22904
Substrate/Competitorn/a
Ki 1±n/a nM
CommentsPDSP_272
Citation Hill SJ Multiple histamine receptors: properties and functional characteristics. Biochem Soc Trans 20:122-5 (1992) [PubMed]  Article
More Info.:Get all data from this article
 
Histamine H2 receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2 | Histamine H2-Gs alpha S
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40567.22
Organism:Cavia porcellus (domestic guinea pig)
Description:For the H2 receptor-binding assays, guinea pig striatum was used.
Residue:359
Sequence:
MAFNGTVPSFCMDFTVYKVTISVILIILILVTVAGNVVVCLAVGLNRRLRSLTNCFIVSL
AVTDLLLGLLVLPFSAIYQLSCKWSFSKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLITPARVAISLVFIWVISITLSFLSIHLGWNSRNETSKDNDTIVKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYFRIFKIAREQARRINHIGSWKAATIREHKATVTLAAVM
GAFIICWFPYFTVFVYRGLKGDDAVNEVFEDVVLWLGYANSALNPILYAALNRDFRTAYH
QLFCCRLASHNSHETSLRLNNSQLNRSQCQEPRWQEDKPLNLQVWSGTEVTAPQGATNR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22904
n/a
NameBDBM22904
Synonyms:(2R)-1-(1H-imidazol-5-yl)propan-2-amine | (R)-alpha-Methylhistamine | Alpha-Methylhistamine-R | Alpha-Methylhistane-R | CHEMBL268229 | R-alpha-methylhistamine | RAMH
TypeSmall organic molecule
Emp. Form.C6H11N3
Mol. Mass.125.1716
SMILESC[C@@H](N)Cc1cnc[nH]1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: