Reaction Details |
| Report a problem with these data |
Target | Cannabinoid receptor 2 |
---|
Ligand | BDBM50295926 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Binding Assay |
---|
Ki | 43.9±5 nM |
---|
Citation | Schuehly, W; Paredes, JM; Kleyer, J; Huefner, A; Anavi-Goffer, S; Raduner, S; Altmann, KH; Gertsch, J Mechanisms of Osteoclastogenesis Inhibition by a Novel Class of Biphenyl-Type Cannabinoid CB(2) Receptor Inverse Agonists. Chem Biol18:1053-64 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cannabinoid receptor 2 |
---|
Name: | Cannabinoid receptor 2 |
Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 39690.94 |
Organism: | Homo sapiens (Human) |
Description: | P34972 |
Residue: | 360 |
Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
BDBM50295926 |
---|
n/a |
---|
Name | BDBM50295926 |
Synonyms: | 4'-O-methylhonokiol, MH | 4-methoxyhonokiol | 5,3'-Diallyl-4'-methoxy-biphenyl-2-ol | CHEMBL89700 | Magreth-14a | Methylhonokiol |
Type | Small organic molecule |
Emp. Form. | C19H20O2 |
Mol. Mass. | 280.3609 |
SMILES | COc1ccc(cc1CC=C)-c1cc(CC=C)ccc1O |
Structure |
|