Reaction Details |
| Report a problem with these data |
Target | p53 binding protein |
---|
Ligand | BDBM81633 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | HDM2 Binding Assay |
---|
IC50 | 2.9e+4±n/a nM |
---|
Citation | Cummings, MD; Schubert, C; Parks, DJ; Calvo, RR; LaFrance, LV; Lattanze, J; Milkiewicz, KL; Lu, T Substituted 1,4-benzodiazepine-2,5-diones as alpha-helix mimetic antagonists of the HDM2-p53 protein-protein interaction. Chem Biol Drug Des67:201-5 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
p53 binding protein |
---|
Name: | p53 binding protein |
Synonyms: | HDM2 | HDM2-HD1 protein | HDM2-p53 protein | P53 binding protein |
Type: | Protein |
Mol. Mass.: | 10726.49 |
Organism: | Homo sapiens (Human) |
Description: | Q9H4C2 |
Residue: | 98 |
Sequence: | MCNTNMSVPTDGAVTTSQIPASEQETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHG
KTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
|
|
|
BDBM81633 |
---|
n/a |
---|
Name | BDBM81633 |
Synonyms: | BZD Scaffold, 3 |
Type | Small organic molecule |
Emp. Form. | C23H16IN2O4 |
Mol. Mass. | 511.2892 |
SMILES | [O-]C(=O)C(N1C(c2ccccc2)C(=O)Nc2ccc(I)cc2C1=O)c1ccccc1 |
Structure |
|