Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M4
LigandBDBM50002338
Substrate/Competitorn/a
Ki 9±n/a nM
CommentsPDSP_1849
Citation Bolden CCusack BRichelson E Antagonism by antimuscarinic and neuroleptic compounds at the five cloned human muscarinic cholinergic receptors expressed in Chinese hamster ovary cells. J Pharmacol Exp Ther 260:576-80 (1992) [PubMed]
More Info.:Get all data from this article
 
Muscarinic acetylcholine receptor M4
Name:Muscarinic acetylcholine receptor M2 and M4
Synonyms:CHRM4 | Cholinergic, muscarinic M4 | Muscarinic acetylcholine receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:53079.31
Organism:Homo sapiens (Human)
Description:Cholinergic, muscarinic M4 CHRM4 HUMAN M3::P08173
Residue:479
Sequence:
MANFTPVNGSSGNQSVRLVTSSSHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVN
RQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASV
MNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTV
PDNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAK
TLAFLKSPLMKQSVKKPPPGEAAREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGS
ATQNTKERPATELSTTEATTPAMPAPPLQPRALNPASRWSKIQIVTKQTGNECVTAIEIV
PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV
LVNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002338
n/a
NameBDBM50002338
Synonyms:(Thioridazine)10-[2-(1-Methyl-piperidin-2-yl)-ethyl]-2-methylsulfanyl-10H-phenothiazine | 10-(2-(1-methylpiperidin-2-yl)ethyl)-2-(methylthio)-10H-phenothiazine | 10-[2-(1-Methyl-piperidin-2-yl)-ethyl]-2-methylsulfanyl-10H-phenothiazine | 10-[2-(1-Methyl-piperidin-2-yl)-ethyl]-2-methylsulfanyl-10H-phenothiazine (thioridazine) | CHEMBL479 | MELLARIL | MELLARIL-S | THIORIDAZINE | TP-21 | US9504692, Thioridazine
TypeSmall organic molecule
Emp. Form.C21H26N2S2
Mol. Mass.370.575
SMILESCSc1ccc2Sc3ccccc3N(CCC3CCCCN3C)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: