Reaction Details |
| Report a problem with these data |
Target | Alpha-2C adrenergic receptor |
---|
Ligand | BDBM50030622 |
---|
Substrate/Competitor | n/a |
---|
Ki | 20±n/a nM |
---|
Comments | PDSP_335 |
---|
Citation | Bylund, DB; Blaxall, HS; Iversen, LJ; Caron, MG; Lefkowitz, RJ; Lomasney, JW Pharmacological characteristics of alpha 2-adrenergic receptors: comparison of pharmacologically defined subtypes with subtypes identified by molecular cloning. Mol Pharmacol42:1-5 (1992) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Alpha-2C adrenergic receptor |
---|
Name: | Alpha-2C adrenergic receptor |
Synonyms: | ADRA2C | adrenergic Alpha2C |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 27257.01 |
Organism: | OK |
Description: | adrenergic Alpha2C ADRA2C OK::G3GWB4 |
Residue: | 230 |
Sequence: | MAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIV
AVWLISAVISFPPLVSFYRRSDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARI
YRFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREAC
QLPEPLFKFFFWIGYCKSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
|
|
|
BDBM50030622 |
---|
n/a |
---|
Name | BDBM50030622 |
Synonyms: | (7aS,8S,11aS,12aR)-8-Methyl-5,6,7a,8,11a,12,12a,13-octahydro-7H-9-oxa-6a,13-diaza-indeno[2,1-a]anthracene-11-carboxylic acid methyl ester | AKUAMMIGINE | CHEMBL122404 |
Type | Small organic molecule |
Emp. Form. | C21H24N2O3 |
Mol. Mass. | 352.4269 |
SMILES | COC(=O)C1=CO[C@@H](C)[C@@H]2CN3CCc4c([nH]c5ccccc45)[C@H]3C[C@H]12 |t:4| |
Structure |
|