| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alpha-2C adrenergic receptor |
|---|
| Ligand | BDBM29568 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 15±n/a nM |
|---|
| Comments | PDSP_1528 |
|---|
| Citation |  Bylund, DB; Blaxall, HS; Iversen, LJ; Caron, MG; Lefkowitz, RJ; Lomasney, JW Pharmacological characteristics of alpha 2-adrenergic receptors: comparison of pharmacologically defined subtypes with subtypes identified by molecular cloning. Mol Pharmacol42:1-5 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Alpha-2C adrenergic receptor |
|---|
| Name: | Alpha-2C adrenergic receptor |
|---|
| Synonyms: | ADRA2C | adrenergic Alpha2C |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 27257.01 |
|---|
| Organism: | OK |
|---|
| Description: | adrenergic Alpha2C ADRA2C OK::G3GWB4 |
|---|
| Residue: | 230 |
|---|
| Sequence: | MAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIV
AVWLISAVISFPPLVSFYRRSDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARI
YRFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREAC
QLPEPLFKFFFWIGYCKSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
|
|
|
|---|
| BDBM29568 |
|---|
| n/a |
|---|
| Name | BDBM29568 |
|---|
| Synonyms: | CHEMBL2 | PRAZOSIN | PRAZOSIN HYDROCHLORIDE | [3H]-Furazosin | [3H]-Minipress | [3H]-Pratsiol | [3H]-Prazosin |
|---|
| Type | radiolabeled ligand |
|---|
| Emp. Form. | C19H21N5O4 |
|---|
| Mol. Mass. | 383.4011 |
|---|
| SMILES | COc1cc2nc(nc(N)c2cc1OC)N1CCN(CC1)C(=O)c1ccco1 |
|---|
| Structure | 
|
|---|
Search and Browse
