Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT5
LigandBDBM50027065
Substrate/Competitorn/a
Ki 3.98±n/a nM
CommentsPDSP_797
Citation Plassat JLBoschert UAmlaiky NHen R The mouse 5HT5 receptor reveals a remarkable heterogeneity within the 5HT1D receptor family. EMBO J 11:4779-86 (1992) [PubMed]
More Info.:Get all data from this article
 
5-HT5
Name:5-HT5
Synonyms:5-HT-5 | 5-HT-5A | 5-HT5a | 5-hydroxytryptamine receptor 5A | Serotonin 5a (5-HT5a) receptor | Serotonin receptor 5A
Type:Enzyme Catalytic Domain
Mol. Mass.:40749.33
Organism:MOUSE
Description:5-HT5 0 MOUSE::P30966
Residue:357
Sequence:
MDLPVNLTSFSLSTPSSLEPNRSLDTEVLRPSRPFLSAFRVLVLTLLGFLAAATFTWNLL
VLATILKVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHLEYTLRTRKRVSNVMILLTWALSTVISLAPLLFG
WGETYSEPSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYRAAKFRMGSRKTNSVS
PVPEAVEVKNATQHPQMVFTVRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVLCWFP
FFVTELISPLCSWDVPAIWKSIFLWLGYSNSFFNPLIYTAFNRSYSSAFKVFFSKQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027065
n/a
NameBDBM50027065
Synonyms:(5'alpha)-12'-hydroxy-2'-methyl-5'-(phenylmethyl)ergotoman-3',6',18-trione | (5'alpha)-5'-benzyl-12'-hydroxy-2'-methyl-3',6',18-trioxoergotaman | 12'-hydroxy-2'-methyl-5'alpha-(phenylmethyl)ergotaman-3',6',18-trione | ERGOTAMINE | Ergotamin
TypeSmall organic molecule
Emp. Form.C33H35N5O5
Mol. Mass.581.6615
SMILESCN1C[C@@H](C=C2[C@H]1Cc1c[nH]c3cccc2c13)C(=O)N[C@]1(C)O[C@@]2(O)[C@@H]3CCCN3C(=O)[C@H](Cc3ccccc3)N2C1=O |r,c:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: