| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1D |
|---|
| Ligand | BDBM50013515 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 40±n/a nM |
|---|
| Comments | PDSP_1590 |
|---|
| Citation |  Weinshank, RL; Zgombick, JM; Macchi, MJ; Branchek, TA; Hartig, PR Human serotonin 1D receptor is encoded by a subfamily of two distinct genes: 5-HT1D alpha and 5-HT1D beta. Proc Natl Acad Sci U S A89:3630-4 (1992) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine receptor 1D |
|---|
| Name: | 5-hydroxytryptamine receptor 1D |
|---|
| Synonyms: | 5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | 5HT1D_HUMAN | HTR1D | HTR1DA | HTRL | Serotonin (5-HT) receptor | Serotonin Receptor 1D |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 41920.63 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells. |
|---|
| Residue: | 377 |
|---|
| Sequence: | MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
|
|
|
|---|
| BDBM50013515 |
|---|
| n/a |
|---|
| Name | BDBM50013515 |
|---|
| Synonyms: | (+)-yohimbine | (16alpha,17alpha)-17-hydroxyyohimban-16-carboxylic acid methyl ester | 17alpha-hydroxyyohimban-16alpha-carboxylic acid methyl ester | CHEMBL15245 | CORYNANTHINE | Johimbin | Quebrachin | RAUWOLSCINE | YOHIMBINE CHLORIDE | Yohimbin | Yohimbine | aphrodine | cid_8969 | corynine | methyl 17alpha-hydroxyyohimban-16alpha-carboxylate | quebrachine | yohimbic acid methyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H26N2O3 |
|---|
| Mol. Mass. | 354.4427 |
|---|
| SMILES | COC(=O)[C@H]1[C@@H](O)CC[C@H]2CN3CCc4c([nH]c5ccccc45)[C@@H]3C[C@H]12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
