| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine 1D receptor |
|---|
| Ligand | BDBM50007406 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 282±n/a nM |
|---|
| Comments | PDSP_1808 |
|---|
| Citation |  Weinshank, RL; Zgombick, JM; Macchi, MJ; Branchek, TA; Hartig, PR Human serotonin 1D receptor is encoded by a subfamily of two distinct genes: 5-HT1D alpha and 5-HT1D beta. Proc Natl Acad Sci U S A89:3630-4 (1992) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine 1D receptor |
|---|
| Name: | 5-hydroxytryptamine 1D receptor |
|---|
| Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 12731.52 |
|---|
| Organism: | Bos taurus (Bovine) |
|---|
| Description: | Q8MI13 |
|---|
| Residue: | 119 |
|---|
| Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
|---|
| BDBM50007406 |
|---|
| n/a |
|---|
| Name | BDBM50007406 |
|---|
| Synonyms: | 1-(3-(trifluoromethyl)phenyl)piperazine | 1-(3-Trifluoromethyl-phenyl)-piperazine | 1-(3-Trifluoromethyl-phenyl)-piperazine(TFMPP) | CHEMBL274866 | TFMPP |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H13F3N2 |
|---|
| Mol. Mass. | 230.2295 |
|---|
| SMILES | FC(F)(F)c1cccc(c1)N1CCNCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
