Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene D4 Beta
LigandBDBM50009075
Substrate/Competitorn/a
Ki 6.89±n/a nM
CommentsPDSP_953
Citation Shirley JTCheng JB Competition of leukotrienes and ICI-198,615 for [3H]LTD4 binding sites in guinea pig lung membranes suggests the involvement of two LTD4 receptor subtypes. J Pharmacol Exp Ther 258:531-6 (1991) [PubMed]
More Info.:Get all data from this article
 
Leukotriene D4 Beta
Name:Leukotriene D4 Beta
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:37633.32
Organism:GUINEA PIG
Description:Leukotriene D4 Beta 0 GUINEA PIG::I3LE30
Residue:351
Sequence:
MAMNTTSPAASSSPPVMFISLLAIIPLSVALAVGLPGNSFVVWSILAKMRKRSVTALLVL
HLALADLAVLLTAPFFLHSVAQGNWTFGLAGCRLFHYICGVSMYASVLLITAMSLDRSLA
VARPFVSQKLRTKAVAWRVLAGIWVASVLLATPVIVYRKVILKQNNRSLVCLPMYPSEGH
RAFHLFFEVITGFLLPFLAVVASYSDIGRRLRTRRFRRSRRMGRLVVLIILAFAAFWLPY
HVVNLAEAVRALTGKASGAGAVGKGLWLARQVFITLAFLSSSVNPVLYACAGGGLLRSAG
VGFVAKLLEGTGSEASSTRRGGTLGQTVRGDVASPEPGPTESLTVSTNPLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009075
n/a
NameBDBM50009075
Synonyms:CHEMBL22033 | ICI 198615 | ICI-198615 | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-5-yl]-carbamic acid cyclopentyl ester | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-6-yl]-carbamic acid cyclopentyl ester | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-6-yl]-carbamic acid cyclopentyl ester (ICI 198,615) | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-6-yl]-carbamic acid cyclopentyl ester(ICI 198, 615) | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-6-yl]-carbamic acid cyclopentyl ester(ICI 198615)
TypeSmall organic molecule
Emp. Form.C28H28N4O6S
Mol. Mass.548.61
SMILESCOc1cc(ccc1Cn1ncc2ccc(NC(=O)OC3CCCC3)cc12)C(=O)NS(=O)(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: