Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene D4 Beta
LigandBDBM50297387
Substrate/Competitorn/a
Ki 35.5±n/a nM
CommentsPDSP_1117
Citation Shirley JTCheng JB Competition of leukotrienes and ICI-198,615 for [3H]LTD4 binding sites in guinea pig lung membranes suggests the involvement of two LTD4 receptor subtypes. J Pharmacol Exp Ther 258:531-6 (1991) [PubMed]
More Info.:Get all data from this article
 
Leukotriene D4 Beta
Name:Leukotriene D4 Beta
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:37633.32
Organism:GUINEA PIG
Description:Leukotriene D4 Beta 0 GUINEA PIG::I3LE30
Residue:351
Sequence:
MAMNTTSPAASSSPPVMFISLLAIIPLSVALAVGLPGNSFVVWSILAKMRKRSVTALLVL
HLALADLAVLLTAPFFLHSVAQGNWTFGLAGCRLFHYICGVSMYASVLLITAMSLDRSLA
VARPFVSQKLRTKAVAWRVLAGIWVASVLLATPVIVYRKVILKQNNRSLVCLPMYPSEGH
RAFHLFFEVITGFLLPFLAVVASYSDIGRRLRTRRFRRSRRMGRLVVLIILAFAAFWLPY
HVVNLAEAVRALTGKASGAGAVGKGLWLARQVFITLAFLSSSVNPVLYACAGGGLLRSAG
VGFVAKLLEGTGSEASSTRRGGTLGQTVRGDVASPEPGPTESLTVSTNPLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50297387
n/a
NameBDBM50297387
Synonyms:(5S,6R,7E,9E,11Z,14Z)-6-(cystein-S-yl)-5-hydroxyicosa-7,9,11,14-tetraenoic acidS-{(1R,2E,4E,6Z,9Z)-1-[(1S)-4-carboxy-1-hydroxybutyl]pentadeca-2,4,6,9-tetraen-1-yl}-L-cysteine | (5S-(5R*,6S*(S*),7E,9E,11Z,14Z))-6-((2-Amino-2-carboxyethyl)thio)-5-hydroxy-7,9,11,14-eicosatetraenoic acid | 5S-hydroxy,6R-(S-cysteinyl),7E,9E,11Z,14Z-eicosatetraenoic acid | CHEMBL509456 | LTE4 | leukotriene E4
TypeSmall organic molecule
Emp. Form.C23H37NO5S
Mol. Mass.439.609
SMILESCCCCC\C=C/C\C=C/C=C/C=C/[C@@H](SC[C@H](N)C(O)=O)[C@@H](O)CCCC(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: