Reaction Details |
| Report a problem with these data |
Target | Alpha-2C adrenergic receptor |
---|
Ligand | BDBM50002338 |
---|
Substrate/Competitor | n/a |
---|
Ki | 549±n/a nM |
---|
Comments | PDSP_1849 |
---|
Citation | Blaxall, HS; Murphy, TJ; Baker, JC; Ray, C; Bylund, DB Characterization of the alpha-2C adrenergic receptor subtype in the opossum kidney and in the OK cell line. J Pharmacol Exp Ther259:323-9 (1991) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Alpha-2C adrenergic receptor |
---|
Name: | Alpha-2C adrenergic receptor |
Synonyms: | ADRA2C | adrenergic Alpha2C |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 27257.01 |
Organism: | OK |
Description: | adrenergic Alpha2C ADRA2C OK::G3GWB4 |
Residue: | 230 |
Sequence: | MAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIV
AVWLISAVISFPPLVSFYRRSDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARI
YRFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREAC
QLPEPLFKFFFWIGYCKSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
|
|
|
BDBM50002338 |
---|
n/a |
---|
Name | BDBM50002338 |
Synonyms: | (Thioridazine)10-[2-(1-Methyl-piperidin-2-yl)-ethyl]-2-methylsulfanyl-10H-phenothiazine | 10-(2-(1-methylpiperidin-2-yl)ethyl)-2-(methylthio)-10H-phenothiazine | 10-[2-(1-Methyl-piperidin-2-yl)-ethyl]-2-methylsulfanyl-10H-phenothiazine | 10-[2-(1-Methyl-piperidin-2-yl)-ethyl]-2-methylsulfanyl-10H-phenothiazine (thioridazine) | CHEMBL479 | MELLARIL | MELLARIL-S | THIORIDAZINE | TP-21 | US9504692, Thioridazine |
Type | Small organic molecule |
Emp. Form. | C21H26N2S2 |
Mol. Mass. | 370.575 |
SMILES | CSc1ccc2Sc3ccccc3N(CCC3CCCCN3C)c2c1 |
Structure |
|