Reaction Details |
| Report a problem with these data |
Target | Calcium release-activated calcium channel protein 1 |
---|
Ligand | BDBM81819 |
---|
Substrate/Competitor | n/a |
---|
Ki | 2700±n/a nM |
---|
Comments | PDSP_2652 |
---|
Citation | Garritsen, A; Ijzerman, AP; Tulp, MT; Cragoe, EJ; Soudijn, W Receptor binding profiles of amiloride analogues provide no evidence for a link between receptors and the Na+/H+ exchanger, but indicate a common structure on receptor proteins. J Recept Res11:891-907 (1991) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Calcium release-activated calcium channel protein 1 |
---|
Name: | Calcium release-activated calcium channel protein 1 |
Synonyms: | CRACM1 | CRCM1_HUMAN | Calcium channel (VER) | Calcium release-activated calcium channel | Calcium release-activated calcium channel protein 1 | ORAI1 | Protein orai-1 | TMEM142A | Transmembrane protein 142A |
Type: | Protein |
Mol. Mass.: | 32676.63 |
Organism: | Homo sapiens (Human) |
Description: | Q96D31 |
Residue: | 301 |
Sequence: | MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSY
SEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLL
IAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFST
VIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIAST
TIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHY
A
|
|
|
BDBM81819 |
---|
n/a |
---|
Name | BDBM81819 |
Synonyms: | Benzamil | CAS_1937-37-7 | CHEMBL212579 | NSC_108107 |
Type | Small organic molecule |
Emp. Form. | C13H14ClN7O |
Mol. Mass. | 319.75 |
SMILES | NC(NC(=O)c1nc(Cl)c(N)nc1N)=NCc1ccccc1 |w:14.15| |
Structure |
|