| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Pro-thyrotropin-releasing hormone |
|---|
| Ligand | BDBM81819 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_2652 |
|---|
| Citation |  Garritsen, A; Ijzerman, AP; Tulp, MT; Cragoe, EJ; Soudijn, W Receptor binding profiles of amiloride analogues provide no evidence for a link between receptors and the Na+/H+ exchanger, but indicate a common structure on receptor proteins. J Recept Res11:891-907 (1991) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Pro-thyrotropin-releasing hormone |
|---|
| Name: | Pro-thyrotropin-releasing hormone |
|---|
| Synonyms: | Prothyroliberin | TRH_RAT | Trh |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 29277.96 |
|---|
| Organism: | RAT |
|---|
| Description: | TRH 0 RAT::P01150 |
|---|
| Residue: | 255 |
|---|
| Sequence: | MPGPWLLLALALIFTLTGIPESCALPEAAQEEGAVTPDLPGLENVQVRPERRFLWKDLQR
VRGDLGAALDSWITKRQHPGKREEEEKDIEAEERGDLGEGGAWRLHKRQHPGRRANQDKY
SWADEEDSDWMPRSWLPDFFLDSWFSDVPQVKRQHPGRRSFPWMESDVTKRQHPGRRFID
PELQRSWEEKEGEGVLMPEKRQHPGKRALGHPCGPQGTCGQTGLLQLLGDLSRGQETLVK
QSPQVEPWDKEPLEE
|
|
|
|---|
| BDBM81819 |
|---|
| n/a |
|---|
| Name | BDBM81819 |
|---|
| Synonyms: | Benzamil | CAS_1937-37-7 | CHEMBL212579 | NSC_108107 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H14ClN7O |
|---|
| Mol. Mass. | 319.75 |
|---|
| SMILES | NC(NC(=O)c1nc(Cl)c(N)nc1N)=NCc1ccccc1 |w:14.15| |
|---|
| Structure | 
|
|---|
Search and Browse
