Reaction Details |
| Report a problem with these data |
Target | Pituitary adenylate cyclase-activating polypeptide |
---|
Ligand | BDBM81823 |
---|
Substrate/Competitor | n/a |
---|
Ki | 40±n/a nM |
---|
Comments | PDSP_2613 |
---|
Citation | Schäfer, H; Schwarzhoff, R; Creutzfeldt, W; Schmidt, WE Characterization of a guanosine-nucleotide-binding-protein-coupled receptor for pituitary adenylate-cyclase-activating polypeptide on plasma membranes from rat brain. Eur J Biochem202:951-8 (1991) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Pituitary adenylate cyclase-activating polypeptide |
---|
Name: | Pituitary adenylate cyclase-activating polypeptide |
Synonyms: | Adcyap1 | PACAP | PACAP-27 | PACAP-38 | PACA_RAT | Pituitary adenylate cyclase-activating polypeptide |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 19565.66 |
Organism: | RAT |
Description: | PACAP 0 RAT::P13589 |
Residue: | 175 |
Sequence: | MTMCSGARLALLVYGIIMHNSVSCSPAAGLSFPGIRPEEEAYDQDGNPLQDFYDWDPPGA
GSPASALRDAYALYYPADRRDVAHEILNEAYRKVLDQLSARKYLQSMVARGMGENLAAAA
VDDRAPLTKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
|
|
|
BDBM81823 |
---|
n/a |
---|
Name | BDBM81823 |
Synonyms: | CAS_444121 | GTP[S] | NSC_444121 |
Type | Small organic molecule |
Emp. Form. | C10H16N5O13P3S |
Mol. Mass. | 539.246 |
SMILES | Nc1nc2n(cnc2c(=O)[nH]1)C1OC(COP(O)(=O)OP(O)(=O)OP(O)(S)=O)C(O)C1O |
Structure |
|