| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Pituitary adenylate cyclase-activating polypeptide |
|---|
| Ligand | BDBM50250019 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1.9±n/a nM |
|---|
| Comments | PDSP_2377 |
|---|
| Citation |  Schäfer, H; Schwarzhoff, R; Creutzfeldt, W; Schmidt, WE Characterization of a guanosine-nucleotide-binding-protein-coupled receptor for pituitary adenylate-cyclase-activating polypeptide on plasma membranes from rat brain. Eur J Biochem202:951-8 (1991) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Pituitary adenylate cyclase-activating polypeptide |
|---|
| Name: | Pituitary adenylate cyclase-activating polypeptide |
|---|
| Synonyms: | Adcyap1 | PACAP | PACAP-27 | PACAP-38 | PACA_RAT | Pituitary adenylate cyclase-activating polypeptide |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 19565.66 |
|---|
| Organism: | RAT |
|---|
| Description: | PACAP 0 RAT::P13589 |
|---|
| Residue: | 175 |
|---|
| Sequence: | MTMCSGARLALLVYGIIMHNSVSCSPAAGLSFPGIRPEEEAYDQDGNPLQDFYDWDPPGA
GSPASALRDAYALYYPADRRDVAHEILNEAYRKVLDQLSARKYLQSMVARGMGENLAAAA
VDDRAPLTKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
|
|
|
|---|
| BDBM50250019 |
|---|
| n/a |
|---|
| Name | BDBM50250019 |
|---|
| Synonyms: | CHEMBL524658 | PACAP | PACAP(1-38) | PACAP-38 | PACAP38 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C203H331N63O53S |
|---|
| Mol. Mass. | 4534.256 |
|---|
| SMILES | n/a |
|---|
| Structure | 
|
|---|
Search and Browse
