Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1
LigandBDBM50018056
Substrate/Competitorn/a
Ki 540±n/a nM
CommentsPDSP_246
Citation Mei LLai JYamamura HIRoeske WR Pharmacologic comparison of selected agonists for the M1 muscarinic receptor in transfected murine fibroblast cells (B82). J Pharmacol Exp Ther 256:689-94 (1991) [PubMed]
More Info.:Get all data from this article
 
Muscarinic acetylcholine receptor M1
Name:Muscarinic acetylcholine receptor M1 and M3
Synonyms:CHRM1 | Cholinergic receptor, muscarinic 1 | Cholinergic, muscarinic M1
Type:Protein
Mol. Mass.:51442.54
Organism:Homo sapiens (Human)
Description:P11229
Residue:460
Sequence:
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50018056
n/a
NameBDBM50018056
Synonyms:(AF-DX 116) 11-[2-(2-Diethylaminomethyl-piperidin-1-yl)-acetyl]-5,11-dihydro-benzo[e]pyrido[3,2-b][1,4]diazepin-6-one | 11-[2-(2-Diethylaminomethyl-piperidin-1-yl)-acetyl]-5,11-dihydro-benzo[e]pyrido[3,2-b][1,4]diazepin-6-one | 2-Diethylaminomethyl-1-[2-oxo-2-(6-oxo-5,6-dihydro-benzo[e]pyrido[3,2-b][1,4]diazepin-11-yl)-ethyl]-piperidinium | 5-{2-[2-(2-Dipropylamino-ethyl)-piperidin-1-yl]-acetyl}-5,10-dihydro-dibenzo[b,e][1,4]diazepin-11-one | AF-DX 116 | AF-DX 116,(+/-) | CHEMBL17045 | Otenzepad
TypeSmall organic molecule
Emp. Form.C24H31N5O2
Mol. Mass.421.5352
SMILESCCN(CC)CC1CCCCN1CC(=O)N1c2ccccc2C(=O)Nc2cccnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: