Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCerebral cortex alpha adrenergic receptor
LigandBDBM36024
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_1482
Citation Lomasney JWCotecchia SLorenz WLeung WYSchwinn DAYang-Feng TLBrownstein MLefkowitz RJCaron MG Molecular cloning and expression of the cDNA for the alpha 1A-adrenergic receptor. The gene for which is located on human chromosome 5. J Biol Chem 266:6365-9 (1991) [PubMed]
More Info.:Get all data from this article
 
Cerebral cortex alpha adrenergic receptor
Name:Cerebral cortex alpha adrenergic receptor
Synonyms:Alpha 1A-adrenoceptor | Alpha 1A-adrenoreceptor | Alpha-1C adrenergic receptor | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha1
Type:Enzyme Catalytic Domain
Mol. Mass.:51492.08
Organism:CALF
Description:adrenergic Alpha1 0 CALF
Residue:466
Sequence:
MVFLSGNASDSSNCTHPPPPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNVWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
AQVGGSGVTSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FRPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHTLGYTL
HAPSHVLEGQHKDLVRIPVGSAETFYKISKTDGVCEWKIFSSLPRGSARMAVARDPSACT
TARVRSKSFLQVCCCLGPSTPSHGENHQIPTIKIHTISLSENGEEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36024
n/a
NameBDBM36024
Synonyms:(R)-(-)-phenylephrine | PHENYLEPHRINE | Phenylephrine,(-)
TypeGuest
Emp. Form.C9H14NO2
Mol. Mass.168.2124
SMILESC[NH2+]C[C@H](O)c1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: