Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDRD2
LigandBDBM50005120
Substrate/Competitorn/a
Ki 0.06±n/a nM
CommentsPDSP_1981
Citation Van Tol HHBunzow JRGuan HCSunahara RKSeeman PNiznik HBCivelli O Cloning of the gene for a human dopamine D4 receptor with high affinity for the antipsychotic clozapine. Nature 350:610-4 (1991) [PubMed]  Article
More Info.:Get all data from this article
 
DRD2
Name:DRD2
Synonyms:DOPAMINE D2 Long | DOPAMINE D4 | Dopamine receptor D4
Type:Enzyme Catalytic Domain
Mol. Mass.:43731.97
Organism:CANINE
Description:Q589Y6
Residue:421
Sequence:
AGDADGLLAGRGPGAGTPGTPGAAAALAGGVLLIGAVLAGNALVCASVAAERALQTPTNY
FIVSLAAADLLLALLVLPLFVYSEVQGGVWLFSPGLCDALMAMDVMLCTASIFNLCAISV
DRFVAVAVPLSYNRQGGGGRQLLLIGATWLLSAAVAAPVLCGLNDARGRDPAVCRLEDRD
YVVYSSVCSFFLPCPLMLLLYWATFRGLRRWEAARRAKLHGRTPRRPSGPGPPPPDGSPD
GTPGPPPPDGSPDGTSDGTPGPPPPDGSPDGTPGPPPPDGSPDDNPRPPPPDSSPGPPPP
EVTPDDTPDATPRPLPPAADAAAPPPADPAEPPRQPRKRRRAKITGRERKAMRVLPVVVG
AFLLCWTPFFVVHITRALCPACPVPPRLVSAVTWLGYVNSALNPLIYTVFNAEFRAVFRK
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005120
n/a
NameBDBM50005120
Synonyms:CHEMBL274491 | N-((2S,3S)-1-Benzyl-2-methyl-pyrrolidin-3-yl)-5-chloro-2-methoxy-4-methylamino-benzamide | N-(1-Benzyl-2-methyl-pyrrolidin-3-yl)-5-chloro-2-methoxy-4-methylamino-benzamide | Nemonapride | YM-09151-2
TypeSmall organic molecule
Emp. Form.C21H26ClN3O2
Mol. Mass.387.903
SMILESCNc1cc(OC)c(cc1Cl)C(=O)N[C@H]1CCN(Cc2ccccc2)[C@H]1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: