Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDRD2
LigandBDBM50007518
Substrate/Competitorn/a
Ki 2.1±n/a nM
CommentsPDSP_802
Citation Van Tol HHBunzow JRGuan HCSunahara RKSeeman PNiznik HBCivelli O Cloning of the gene for a human dopamine D4 receptor with high affinity for the antipsychotic clozapine. Nature 350:610-4 (1991) [PubMed]  Article
More Info.:Get all data from this article
 
DRD2
Name:DRD2
Synonyms:DOPAMINE D2 Long | DOPAMINE D4 | Dopamine receptor D4
Type:Enzyme Catalytic Domain
Mol. Mass.:43731.97
Organism:CANINE
Description:Q589Y6
Residue:421
Sequence:
AGDADGLLAGRGPGAGTPGTPGAAAALAGGVLLIGAVLAGNALVCASVAAERALQTPTNY
FIVSLAAADLLLALLVLPLFVYSEVQGGVWLFSPGLCDALMAMDVMLCTASIFNLCAISV
DRFVAVAVPLSYNRQGGGGRQLLLIGATWLLSAAVAAPVLCGLNDARGRDPAVCRLEDRD
YVVYSSVCSFFLPCPLMLLLYWATFRGLRRWEAARRAKLHGRTPRRPSGPGPPPPDGSPD
GTPGPPPPDGSPDGTSDGTPGPPPPDGSPDGTPGPPPPDGSPDDNPRPPPPDSSPGPPPP
EVTPDDTPDATPRPLPPAADAAAPPPADPAEPPRQPRKRRRAKITGRERKAMRVLPVVVG
AFLLCWTPFFVVHITRALCPACPVPPRLVSAVTWLGYVNSALNPLIYTVFNAEFRAVFRK
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007518
n/a
NameBDBM50007518
Synonyms:(S)-3-chloro-5-ethyl-N-((1-ethylpyrrolidin-2-yl)methyl)-6-hydroxy-2-methoxybenzamide | 3,5-Dichloro-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2-hydroxy-6-methoxy-benzamide | 3-Chloro-5-ethyl-N-((S)-1-ethyl-pyrrolidin-2-ylmethyl)-6-hydroxy-2-methoxy-benzamide | 3-Chloro-5-ethyl-N-(1-ethyl-pyrrolidin-2-ylmethyl)-6-hydroxy-2-methoxy-benzamide | 3-Chloro-5-ethyl-N-(1-ethyl-pyrrolidin-2-ylmethyl)-6-hydroxy-2-methoxy-benzamide (etichlopride) | 3-Chloro-5-ethyl-N-(1-ethyl-pyrrolidin-2-ylmethyl)-6-hydroxy-2-methoxy-benzamide(Eticlopride) | 3-chloro-5-ethyl-N-{[(2S)-1-ethylpyrrolidin-2-yl]methyl}-6-hydroxy-2-methoxybenzamide | CHEMBL8946 | ETICLOPRIDE | ETICLOPRIDE,S(-) | Eticlopride;3-Chloro-5-ethyl-N-(1-ethyl-pyrrolidin-2-ylmethyl)-6-hydroxy-2-methoxy-benzamide
TypeSmall organic molecule
Emp. Form.C17H25ClN2O3
Mol. Mass.340.845
SMILESCCN1CCC[C@H]1CNC(=O)c1c(O)c(CC)cc(Cl)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: