Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDRD2
LigandBDBM50007568
Substrate/Competitorn/a
Ki 0.6±n/a nM
CommentsPDSP_3956
Citation Van Tol HHBunzow JRGuan HCSunahara RKSeeman PNiznik HBCivelli O Cloning of the gene for a human dopamine D4 receptor with high affinity for the antipsychotic clozapine. Nature 350:610-4 (1991) [PubMed]  Article
More Info.:Get all data from this article
 
DRD2
Name:DRD2
Synonyms:DOPAMINE D2 Long | DOPAMINE D4 | Dopamine receptor D4
Type:Enzyme Catalytic Domain
Mol. Mass.:43731.97
Organism:CANINE
Description:Q589Y6
Residue:421
Sequence:
AGDADGLLAGRGPGAGTPGTPGAAAALAGGVLLIGAVLAGNALVCASVAAERALQTPTNY
FIVSLAAADLLLALLVLPLFVYSEVQGGVWLFSPGLCDALMAMDVMLCTASIFNLCAISV
DRFVAVAVPLSYNRQGGGGRQLLLIGATWLLSAAVAAPVLCGLNDARGRDPAVCRLEDRD
YVVYSSVCSFFLPCPLMLLLYWATFRGLRRWEAARRAKLHGRTPRRPSGPGPPPPDGSPD
GTPGPPPPDGSPDGTSDGTPGPPPPDGSPDGTPGPPPPDGSPDDNPRPPPPDSSPGPPPP
EVTPDDTPDATPRPLPPAADAAAPPPADPAEPPRQPRKRRRAKITGRERKAMRVLPVVVG
AFLLCWTPFFVVHITRALCPACPVPPRLVSAVTWLGYVNSALNPLIYTVFNAEFRAVFRK
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007568
n/a
NameBDBM50007568
Synonyms:1-((S)-8-Chloro-10,11-dihydro-dibenzo[b,f]thiepin-10-yl)-4-methyl-piperazine | 1-(8-Chloro-10,11-dihydro-dibenzo[b,f]thiepin-10-yl)-4-methyl-piperazine | CHEMBL303313 | OCTOCLOTHEPIN-S
TypeSmall organic molecule
Emp. Form.C19H21ClN2S
Mol. Mass.344.901
SMILESCN1CCN(CC1)[C@H]1Cc2ccccc2Sc2ccc(Cl)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: