Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDRD2
LigandBDBM79181
Substrate/Competitorn/a
Ki 3±n/a nM
CommentsPDSP_1908
Citation Van Tol HHBunzow JRGuan HCSunahara RKSeeman PNiznik HBCivelli O Cloning of the gene for a human dopamine D4 receptor with high affinity for the antipsychotic clozapine. Nature 350:610-4 (1991) [PubMed]  Article
More Info.:Get all data from this article
 
DRD2
Name:DRD2
Synonyms:DOPAMINE D2 Long | DOPAMINE D4 | Dopamine receptor D4
Type:Enzyme Catalytic Domain
Mol. Mass.:43731.97
Organism:CANINE
Description:Q589Y6
Residue:421
Sequence:
AGDADGLLAGRGPGAGTPGTPGAAAALAGGVLLIGAVLAGNALVCASVAAERALQTPTNY
FIVSLAAADLLLALLVLPLFVYSEVQGGVWLFSPGLCDALMAMDVMLCTASIFNLCAISV
DRFVAVAVPLSYNRQGGGGRQLLLIGATWLLSAAVAAPVLCGLNDARGRDPAVCRLEDRD
YVVYSSVCSFFLPCPLMLLLYWATFRGLRRWEAARRAKLHGRTPRRPSGPGPPPPDGSPD
GTPGPPPPDGSPDGTSDGTPGPPPPDGSPDGTPGPPPPDGSPDDNPRPPPPDSSPGPPPP
EVTPDDTPDATPRPLPPAADAAAPPPADPAEPPRQPRKRRRAKITGRERKAMRVLPVVVG
AFLLCWTPFFVVHITRALCPACPVPPRLVSAVTWLGYVNSALNPLIYTVFNAEFRAVFRK
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM79181
n/a
NameBDBM79181
Synonyms:10-[3-(4-methyl-1-piperazinyl)propyl]-2-(trifluoromethyl)phenothiazine;hydrochloride | 10-[3-(4-methylpiperazin-1-yl)propyl]-2-(trifluoromethyl)phenothiazine;hydrochloride | 10-[3-(4-methylpiperazino)propyl]-2-(trifluoromethyl)phenothiazine;hydrochloride | MLS001146870 | SMR000059133 | TRIFLUOPERAZINE | TRIFLUOPERAZINE DIHYDROCHLORIDE | Trifluperazine | cid_2913535 | cid_5566
TypeSmall organic molecule
Emp. Form.C21H24F3N3S
Mol. Mass.407.496
SMILESCN1CCN(CCCN2c3ccccc3Sc3ccc(cc23)C(F)(F)F)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: