| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine 1D receptor |
|---|
| Ligand | BDBM50136166 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 3890.45±n/a nM |
|---|
| Comments | PDSP_832 |
|---|
| Citation |  Wong, DT; Threlkeld, PG; Robertson, DW Affinities of fluoxetine, its enantiomers, and other inhibitors of serotonin uptake for subtypes of serotonin receptors. Neuropsychopharmacology5:43-7 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine 1D receptor |
|---|
| Name: | 5-hydroxytryptamine 1D receptor |
|---|
| Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 12731.52 |
|---|
| Organism: | Bos taurus (Bovine) |
|---|
| Description: | Q8MI13 |
|---|
| Residue: | 119 |
|---|
| Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
|---|
| BDBM50136166 |
|---|
| n/a |
|---|
| Name | BDBM50136166 |
|---|
| Synonyms: | (3R)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine | (R)-fluoxetine | CHEMBL153036 | FLUOXETINE | Methyl-[(R)-3-phenyl-3-(4-trifluoromethyl-phenoxy)-propyl]-amine | Methyl-[3-phenyl-3-(4-trifluoromethyl-phenoxy)-propyl]-amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H18F3NO |
|---|
| Mol. Mass. | 309.3261 |
|---|
| SMILES | CNCC[C@@H](Oc1ccc(cc1)C(F)(F)F)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
