Reaction Details |
| Report a problem with these data |
Target | P2Y purinoceptor 2 |
---|
Ligand | BDBM21173 |
---|
Substrate/Competitor | n/a |
---|
Ki | 0.14±n/a nM |
---|
Comments | PDSP_739 |
---|
Citation | Klotz, KN; Vogt, H; Tawfik-Schlieper, H Comparison of A1 adenosine receptors in brain from different species by radioligand binding and photoaffinity labelling. Naunyn Schmiedebergs Arch Pharmacol343:196-201 (1991) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
P2Y purinoceptor 2 |
---|
Name: | P2Y purinoceptor 2 |
Synonyms: | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | ADORA1 | P2RY2 | P2RY2_CRIGR | P2Y purinoceptor 2 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 18813.49 |
Organism: | HAMSTER |
Description: | ADENOSINE A1 ADORA1 HAMSTER::P58825 |
Residue: | 166 |
Sequence: | VHRCLGVLRPLHSLRWGRARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTRITCHDTSA
RELFSHFVAYSSVMLSLLFAVPFSVILVCYVLMARRLLKPAYGTTGGLPRAKRKSVRTIA
LVLAVFTLCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKITRPL
|
|
|
BDBM21173 |
---|
n/a |
---|
Name | BDBM21173 |
Synonyms: | 1,3-dipropyl-8-cyclopentylxanthine | 8-cyclopentyl-1,3-dipropyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione | CHEMBL183 | DPCPX | PD116948 | [3H]DPCPX |
Type | radiolabeled ligand |
Emp. Form. | C16H24N4O2 |
Mol. Mass. | 304.3874 |
SMILES | CCCn1c2nc([nH]c2c(=O)n(CCC)c1=O)C1CCCC1 |
Structure |
|