Reaction Details |
| Report a problem with these data |
Target | P2Y purinoceptor 2 |
---|
Ligand | BDBM50006730 |
---|
Substrate/Competitor | n/a |
---|
Ki | 0.94±n/a nM |
---|
Comments | PDSP_1618 |
---|
Citation | Klotz, KN; Vogt, H; Tawfik-Schlieper, H Comparison of A1 adenosine receptors in brain from different species by radioligand binding and photoaffinity labelling. Naunyn Schmiedebergs Arch Pharmacol343:196-201 (1991) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
P2Y purinoceptor 2 |
---|
Name: | P2Y purinoceptor 2 |
Synonyms: | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | ADORA1 | P2RY2 | P2RY2_CRIGR | P2Y purinoceptor 2 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 18813.49 |
Organism: | HAMSTER |
Description: | ADENOSINE A1 ADORA1 HAMSTER::P58825 |
Residue: | 166 |
Sequence: | VHRCLGVLRPLHSLRWGRARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTRITCHDTSA
RELFSHFVAYSSVMLSLLFAVPFSVILVCYVLMARRLLKPAYGTTGGLPRAKRKSVRTIA
LVLAVFTLCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKITRPL
|
|
|
BDBM50006730 |
---|
n/a |
---|
Name | BDBM50006730 |
Synonyms: | (R)-2-Hydroxymethyl-5-[6-(1-methyl-2-phenyl-ethylamino)-purin-9-yl]-tetrahydro-furan-3,4-diol | (R-PIa) 2-Hydroxymethyl-5-[6-(1-methyl-2-phenyl-ethylamino)-purin-9-yl]-tetrahydro-furan-3,4-diol | (S)-2-Hydroxymethyl-5-[6-(1-methyl-2-phenyl-ethylamino)-purin-9-yl]-tetrahydro-furan-3,4-diol | 2-(hydroxymethyl)-5-{6-[(1-phenylpropan-2-yl)amino]-9H-purin-9-yl}oxolane-3,4-diol | 2-Hydroxymethyl-5-[6-(1-methyl-2-phenyl-ethylamino)-purin-9-yl]-tetrahydro-furan-3,4-diol | CHEMBL274022 | ChEMBL_20163 | D-2-Hydroxymethyl-5-[6-(1-methyl-2-phenyl-ethylamino)-purin-9-yl]-tetrahydro-furan-3,4-diol | L-2-Hydroxymethyl-5-[6-(1-methyl-2-phenyl-ethylamino)-purin-9-yl]-tetrahydro-furan-3,4-diol | R-N6-(2-phenylisopropyl) adenosine | R-PIA | S-PIA |
Type | Small organic molecule |
Emp. Form. | C19H23N5O4 |
Mol. Mass. | 385.417 |
SMILES | CC(Cc1ccccc1)Nc1ncnc2n(cnc12)C1OC(CO)C(O)C1O |
Structure |
|