| Reaction Details |
|---|
 | Report a problem with these data |
| Target | P2Y purinoceptor 2 |
|---|
| Ligand | BDBM50006730 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1763±n/a nM |
|---|
| Comments | PDSP_1738 |
|---|
| Citation |  Klotz, KN; Vogt, H; Tawfik-Schlieper, H Comparison of A1 adenosine receptors in brain from different species by radioligand binding and photoaffinity labelling. Naunyn Schmiedebergs Arch Pharmacol343:196-201 (1991) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| P2Y purinoceptor 2 |
|---|
| Name: | P2Y purinoceptor 2 |
|---|
| Synonyms: | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | ADORA1 | P2RY2 | P2RY2_CRIGR | P2Y purinoceptor 2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 18813.49 |
|---|
| Organism: | HAMSTER |
|---|
| Description: | ADENOSINE A1 ADORA1 HAMSTER::P58825 |
|---|
| Residue: | 166 |
|---|
| Sequence: | VHRCLGVLRPLHSLRWGRARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTRITCHDTSA
RELFSHFVAYSSVMLSLLFAVPFSVILVCYVLMARRLLKPAYGTTGGLPRAKRKSVRTIA
LVLAVFTLCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKITRPL
|
|
|
|---|
| BDBM50006730 |
|---|
| n/a |
|---|
| Name | BDBM50006730 |
|---|
| Synonyms: | (R)-2-Hydroxymethyl-5-[6-(1-methyl-2-phenyl-ethylamino)-purin-9-yl]-tetrahydro-furan-3,4-diol | (R-PIa) 2-Hydroxymethyl-5-[6-(1-methyl-2-phenyl-ethylamino)-purin-9-yl]-tetrahydro-furan-3,4-diol | (S)-2-Hydroxymethyl-5-[6-(1-methyl-2-phenyl-ethylamino)-purin-9-yl]-tetrahydro-furan-3,4-diol | 2-(hydroxymethyl)-5-{6-[(1-phenylpropan-2-yl)amino]-9H-purin-9-yl}oxolane-3,4-diol | 2-Hydroxymethyl-5-[6-(1-methyl-2-phenyl-ethylamino)-purin-9-yl]-tetrahydro-furan-3,4-diol | CHEMBL274022 | ChEMBL_20163 | D-2-Hydroxymethyl-5-[6-(1-methyl-2-phenyl-ethylamino)-purin-9-yl]-tetrahydro-furan-3,4-diol | L-2-Hydroxymethyl-5-[6-(1-methyl-2-phenyl-ethylamino)-purin-9-yl]-tetrahydro-furan-3,4-diol | R-N6-(2-phenylisopropyl) adenosine | R-PIA | S-PIA |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H23N5O4 |
|---|
| Mol. Mass. | 385.417 |
|---|
| SMILES | CC(Cc1ccccc1)Nc1ncnc2n(cnc12)C1OC(CO)C(O)C1O |
|---|
| Structure | 
|
|---|
Search and Browse
