Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50038766
Substrate/Competitorn/a
Ki 6.2±n/a nM
CommentsPDSP_1615
Citation Tahraoui LFloch ACavero I Functional validation of platelet-activating factor receptor sites characterized biochemically by a specific and reproducible [3H]platelet-activating factor binding in human platelets. J Pharmacol Exp Ther 252:1221-7 (1990) [PubMed]
More Info.:Get all data from this article
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF Platelet activating factor | PAF-R | Platelet-activating factor receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:39219.60
Organism:Homo sapiens (Human)
Description:PAF Platelet activating factor PTAFR HUMAN::P25105
Residue:342
Sequence:
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50038766
n/a
NameBDBM50038766
Synonyms:3-Pyridin-3-yl-1H-pyrrolo[1,2-c]thiazole-7-carboxylic acid (3-benzoyl-phenyl)-amide | CHEMBL64449 | RP 59227 | RP 59228 | RP-58467
TypeSmall organic molecule
Emp. Form.C25H19N3O2S
Mol. Mass.425.502
SMILESO=C(Nc1cccc(c1)C(=O)c1ccccc1)c1ccn2C(SCc12)c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: