Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50004656
Substrate/Competitorn/a
Ki 2000±n/a nM
CommentsPDSP_467
Citation Lai JBloom JWYamamura HIRoeske WR Amplification of the rat M2 muscarinic receptor gene by the polymerase chain reaction: functional expression of the M2 muscarinic receptor. Life Sci 47:1001-13 (1990) [PubMed]  Article
More Info.:Get all data from this article
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic receptor M2 and M3
Synonyms:CHRM2 | Cholinergic, muscarinic M2
Type:Enzyme Catalytic Domain
Mol. Mass.:51555.53
Organism:RAT
Description:P10980
Residue:466
Sequence:
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSRDDNSKQTCIKIVTKAQKGDVCTPTSTTVELVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004656
n/a
NameBDBM50004656
Synonyms:(2-Carbamoyloxy-ethyl)-trimethyl-ammonium | (2-Carbamoyloxyethyl)trimethylammonium chloride | (2-Hydroxyethyl)trimethyl ammonium chloride carbamate | (2-Hydroxyethyl)trimethylammonium chloride carbamate | (carbachol)(2-Carbamoyloxy-ethyl)-trimethyl-ammonium | 2-((Aminocarbonyl)oxy)-N,N,N-trimethylethanaminium chloride | 2-((Aminocarbonyl)oxy)-N,N,N-trimethylethanaminum chloride | 2-(carbamoyloxy)-N,N,N-trimethylethanaminium | 2-(carbamoyloxy)-N,N,N-trimethylethanaminium chloride | CARBACHOL | CARBASTAT | CHEMBL14 | Carbachol chloride | Carbamylcholine | Choline carbamate chloride | Choline chloride, carbamate | Choline chlorine carbamate | Karbachol | Karbamoylcholin chlorid | MIOSTAT
TypeSmall organic molecule
Emp. Form.C6H15N2O2
Mol. Mass.147.195
SMILESC[N+](C)(C)CCOC(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: