Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H1 receptor
LigandBDBM50048392
Substrate/Competitorn/a
Ki 29±n/a nM
CommentsPDSP_444
Citation Andersen PH The dopamine inhibitor GBR 12909: selectivity and molecular mechanism of action. Eur J Pharmacol 166:493-504 (1989) [PubMed]  Article
More Info.:Get all data from this article
 
Histamine H1 receptor
Name:Histamine H1 receptor
Synonyms:HISTAMINE H1
Type:Enzyme Catalytic Domain
Mol. Mass.:55716.35
Organism:RAT
Description:HISTAMINE H1 HRH1 RAT::P31390
Residue:486
Sequence:
MSFANTSSTFEDKMCEGNRTAMASPQLLPLVVVLSSISLVTVGLNLLVLYAVHSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLIMTKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLRYRTKTRASATILGAWFFSFLWVIPILGWHHFMPPAPELREDKC
ETDFYNVTWFKIMTAIINFYLPTLLMLWFYVKIYKAVRRHCQHRQLTNGSLPSFSELKLR
SDDTKEGAKKPGRESPWGVLKRPSRDPSVGLDQKSTSEDPKMTSPTVFSQEGERETRPCF
RLDIMQKQSVAEGDVRGSKANDQALSQPKMDEQSLNTCRRISETSEDQTLVDQQSFSRTT
DSDTSIEPGPGRVKSRSGSNSGLDYIKITWKRLRSHSRQYVSGLHLNRERKAAKQLGFIM
AAFILCWIPYFIFFMVIAFCKSCCSEPMHMFTIWLGYINSTLNPLIYPLCNENFKKTFKK
ILHIRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50048392
n/a
NameBDBM50048392
Synonyms:2-(tert-butylamino)-1-(3-chlorophenyl)propan-1-one | BUPROPION | BUPROPION HYDROCHLORIDE | CHEMBL894 | US9944618, Compound ID No. 176
TypeSmall organic molecule
Emp. Form.C13H18ClNO
Mol. Mass.239.741
SMILESCC(NC(C)(C)C)C(=O)c1cccc(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: