Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR1D
LigandBDBM10755
Substrate/Competitorn/a
Ki 1.9±n/a nM
CommentsPDSP_150
Citation Leonhardt SHerrick-Davis KTiteler M Detection of a novel serotonin receptor subtype (5-HT1E) in human brain: interaction with a GTP-binding protein. J Neurochem 53:465-71 (1989) [PubMed]  Article
More Info.:Get all data from this article
 
HTR1D
Name:5-hydroxytryptamine 1D receptor (5HT1D)
Synonyms:n/a
Type:Protein
Mol. Mass.:12731.52
Organism:Bos taurus (Bovine)
Description:Q8MI13
Residue:119
Sequence:
SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10755
n/a
NameBDBM10755
Synonyms:14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT
TypeSmall organic molecule
Emp. Form.C10H12N2O
Mol. Mass.176.2151
SMILESNCCc1c[nH]c2ccc(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: