| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine 1D receptor |
|---|
| Ligand | BDBM50027065 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.9±n/a nM |
|---|
| Comments | PDSP_797 |
|---|
| Citation |  Leonhardt, S; Herrick-Davis, K; Titeler, M Detection of a novel serotonin receptor subtype (5-HT1E) in human brain: interaction with a GTP-binding protein. J Neurochem53:465-71 (1989) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine 1D receptor |
|---|
| Name: | 5-hydroxytryptamine 1D receptor |
|---|
| Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 12731.52 |
|---|
| Organism: | Bos taurus (Bovine) |
|---|
| Description: | Q8MI13 |
|---|
| Residue: | 119 |
|---|
| Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
|---|
| BDBM50027065 |
|---|
| n/a |
|---|
| Name | BDBM50027065 |
|---|
| Synonyms: | (5'alpha)-12'-hydroxy-2'-methyl-5'-(phenylmethyl)ergotoman-3',6',18-trione | (5'alpha)-5'-benzyl-12'-hydroxy-2'-methyl-3',6',18-trioxoergotaman | 12'-hydroxy-2'-methyl-5'alpha-(phenylmethyl)ergotaman-3',6',18-trione | ERGOTAMINE | Ergotamin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H35N5O5 |
|---|
| Mol. Mass. | 581.6615 |
|---|
| SMILES | CN1C[C@@H](C=C2[C@H]1Cc1c[nH]c3cccc2c13)C(=O)N[C@]1(C)O[C@@]2(O)[C@@H]3CCCN3C(=O)[C@H](Cc3ccccc3)N2C1=O |r,c:4| |
|---|
| Structure | 
|
|---|
Search and Browse
