Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine 1D receptor |
---|
Ligand | BDBM50027065 |
---|
Substrate/Competitor | n/a |
---|
Ki | 0.9±n/a nM |
---|
Comments | PDSP_797 |
---|
Citation | Leonhardt, S; Herrick-Davis, K; Titeler, M Detection of a novel serotonin receptor subtype (5-HT1E) in human brain: interaction with a GTP-binding protein. J Neurochem53:465-71 (1989) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
5-hydroxytryptamine 1D receptor |
---|
Name: | 5-hydroxytryptamine 1D receptor |
Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
Type: | Protein |
Mol. Mass.: | 12731.52 |
Organism: | Bos taurus (Bovine) |
Description: | Q8MI13 |
Residue: | 119 |
Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
BDBM50027065 |
---|
n/a |
---|
Name | BDBM50027065 |
Synonyms: | (5'alpha)-12'-hydroxy-2'-methyl-5'-(phenylmethyl)ergotoman-3',6',18-trione | (5'alpha)-5'-benzyl-12'-hydroxy-2'-methyl-3',6',18-trioxoergotaman | 12'-hydroxy-2'-methyl-5'alpha-(phenylmethyl)ergotaman-3',6',18-trione | ERGOTAMINE | Ergotamin |
Type | Small organic molecule |
Emp. Form. | C33H35N5O5 |
Mol. Mass. | 581.6615 |
SMILES | CN1C[C@@H](C=C2[C@H]1Cc1c[nH]c3cccc2c13)C(=O)N[C@]1(C)O[C@@]2(O)[C@@H]3CCCN3C(=O)[C@H](Cc3ccccc3)N2C1=O |r,c:4| |
Structure |
|