Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin B
LigandBDBM81963
Substrate/Competitorn/a
Ki 0.05±n/a nM
CommentsPDSP_2216
Citation Lotti VJChang RS A new potent and selective non-peptide gastrin antagonist and brain cholecystokinin receptor (CCK-B) ligand: L-365,260. Eur J Pharmacol 162:273-80 (1989) [PubMed]  Article
More Info.:Get all data from this article
 
Cholecystokinin B
Name:Cholecystokinin B
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:12528.64
Organism:GUINEA PIG
Description:Cholecystokinin B 0 GUINEA PIG::P01356
Residue:114
Sequence:
MNGGLCLCVLMAVLAAGTLAQPVPPADSAVPGAQEEEAHRRQLRAVQKVDGESRAHLGAL
LARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81963
n/a
NameBDBM81963
Synonyms:CAS_9011-97-6 | CCK | CCK33 | CHOLECYSTOKININ
TypeSmall organic molecule
Emp. Form.C166H261N51O52S4
Mol. Mass.3931.419
SMILESn/a
Structure