Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetadrenergic Alpha2
LigandBDBM36024
Substrate/Competitorn/a
Ki 1467±n/a nM
CommentsPDSP_1482
Citation Boyajian CLLeslie FM Pharmacological evidence for alpha-2 adrenoceptor heterogeneity: differential binding properties of [3H]rauwolscine and [3H]idazoxan in rat brain. J Pharmacol Exp Ther 241:1092-8 (1987) [PubMed]
More Info.:Get all data from this article
 
adrenergic Alpha2
Name:Adrenergic receptor alpha
Synonyms:Alpha-2C adrenergic receptor | adrenergic Alpha2C
Type:Enzyme Catalytic Domain
Mol. Mass.:49890.50
Organism:RAT
Description:adrenergic Alpha2 0 RAT::P22086
Residue:458
Sequence:
MASPALAAALAAAAAEGPNGSDAGEWGSGGGANASGTDWGPPPGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSFYRRPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRGPAGPDGASPTTENGLGKAAGENGHCAPPRTEVEPDESSAAERRRRRGALRR
GGRRREGAEGDTGSADGPGPGLAAEQGARTASRSPGPGGRLSRASSRSVEFFLSRRRRAR
SSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQLPEPLFKFFFW
IGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36024
n/a
NameBDBM36024
Synonyms:(R)-(-)-phenylephrine | PHENYLEPHRINE | Phenylephrine,(-)
TypeGuest
Emp. Form.C9H14NO2
Mol. Mass.168.2124
SMILESC[NH2+]C[C@H](O)c1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: