Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D1 receptor
LigandBDBM81986
Substrate/Competitorn/a
Ki 1.9±n/a nM
CommentsPDSP_3960
Citation Andersen PH Comparison of the pharmacological characteristics of [3H]raclopride and [3H]SCH 23390 binding to dopamine receptors in vivo in mouse brain. Eur J Pharmacol 146:113-20 (1988) [PubMed]  Article
More Info.:Get all data from this article
 
Dopamine D1 receptor
Name:Dopamine receptor
Synonyms:D(1A) dopamine receptor | DOPAMINE D1 | DRD1 | Dopamine receptor
Type:Enzyme
Mol. Mass.:49613.93
Organism:Mus musculus (Mouse)
Description:Q61616
Residue:446
Sequence:
MAPNTSTMDETGLPVERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNF
FVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVDR
YWAISSPFQYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTWPLDGNFTSLED
AEDDNCDTRLSRTYAISSSLISFYIPVAIMIVTYTSIYRIAQKQIRRISALERAAVHAKN
CQTTTGNGNPVECSQSESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFISNCMVPFCGS
EETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFQKAFSTLLGCYRLCPTTNNAIET
VSINNNGAVMFSSHHEPRGSISKDCNLVYLIPHAVGSSEDLKREEAGGIPKPLEKLSPAL
SVILDYDTDVSLEKIQPVTHSGQHST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81986
n/a
NameBDBM81986
Synonyms:3-Methyl-1-phenyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine-7,8-diol; hydrochloride | CAS_173870 | CHEMBL545000 | NSC_173870 | SKF 75670
TypeSmall organic molecule
Emp. Form.C17H19NO2
Mol. Mass.269.3383
SMILESCN1CCc2cc(O)c(O)cc2C(C1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: