Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium channel
LigandBDBM82057
Substrate/Competitorn/a
Ki 45.5±n/a nM
CommentsPDSP_2662
Citation Reynolds IJSnowman AMSnyder SH (-)-[3H] desmethoxyverapamil labels multiple calcium channel modulator receptors in brain and skeletal muscle membranes: differentiation by temperature and dihydropyridines. J Pharmacol Exp Ther 237:731-8 (1986) [PubMed]
More Info.:Get all data from this article
 
Calcium channel
Name:Voltage-gated L-type calcium channel
Synonyms:Calcium channel (Type L) | Calcium channel diltiazem | Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle | RBC | Rat brain class C | Voltage-dependent L-type calcium channel subunit alpha-1C | Voltage-gated L-type calcium channel | Voltage-gated L-type calcium channel alpha-1C subunit | Voltage-gated calcium channel subunit alpha Cav1.2
Type:Enzyme Catalytic Domain
Mol. Mass.:243492.26
Organism:RAT
Description:Calcium channel 0 RAT::P22002
Residue:2169
Sequence:
MIRAFAQPSTPPYQPLSSCLSEDTERKFKGKVVHEAQLNCFYISPGGSNYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWLAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGGTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIIDVPAEEDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEDKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAE
MLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISCWRCVRLLRIFKI
TRYWNSLSNLVASLLNSLRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFISPNYILLNLFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVMEKPAVEESKEEKIELKSIT
ADGESPPTTKINMDDLQPSENEDKSPHSNPDTAGEEDEEEPEMPVGPRPRPLSELHLKEK
AVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRN
HILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSA
INVVKILRVLRVLRPLRINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLF
KGKLYTCSDSSKQTEAESKGNYITYKTGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTV
STFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQE
QGEQEYKNCELDKNQRQCVEYALKARPLPRYIPKNQHQYKVWYVVNSTYFEYLMFVLILL
NTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWNTFDALIV
VGSIVDIAITEVHPAEHTQCSPSMSAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLW
TFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFR
CATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLF
VAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFG
KLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKK
IWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSL
QAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQ
SDSRSNFPQTFATQRPLHINKTGNNQADTESPSHEKLVDSTFTPSSYSSTGSNANINNAN
NTALGRFPHPAGYSSTVSTVEGHGPPLSPAVRVQEAAWKLSSKRCHSRESQGATVSQDMF
PDETRSSVRLSEEVEYCSEPSLLSTDILSYQDDENRQLTCLEEDKREIQPCPKRSFLRSA
SLGRRASFHLECLKRQKDQGGDISQKTALPLHLVHHQALAVAGLSPLLQRSHSPSTFPRP
RPTPPVTPGSRGRPLQPIPTLRLEGAESSEKLNSSFPSIHCSSWSEETTACSGGSSMARR
ARPVSLTVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMT
IEEMENAADNILSGGAQQSPNGTLLPFVNCRDPGQDRAVVPEDESCVYALGRGRSEEALP
DSRSYVSNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82057
n/a
NameBDBM82057
Synonyms:CAS_107928 | CAS_65832 | D888,(+) | D888,(-) | NSC_107928 | NSC_65832
TypeSmall organic molecule
Emp. Form.C26H36N2O3
Mol. Mass.424.5756
SMILESCOc1cccc(CCN(C)CCCC(C#N)(C(C)C)c2ccc(OC)c(OC)c2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: