Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNociceptin/mu opioid receptor
LigandBDBM82064
Substrate/Competitorn/a
Ki 1160±n/a nM
CommentsPDSP_7115
Citation Blanchard SGLee PHPugh WWHong JSChang KJ Characterization of the binding of a morphine (mu) receptor-specific ligand: Tyr-Pro-NMePhe-D-Pro-NH2, [3H]-PL17. Mol Pharmacol 31:326-33 (1987) [PubMed]
More Info.:Get all data from this article
 
Nociceptin/mu opioid receptor
Name:Nociceptin/mu opioid receptor
Synonyms:MOR-1 | MUOR1 | Mu-type opioid receptor | Mu-type opioid receptor (MOR) | OPIATE Mu | Opiate non-selective | Opioid receptor B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44503.11
Organism:Rattus norvegicus (rat)
Description:Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor.
Residue:398
Sequence:
MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82064
n/a
NameBDBM82064
Synonyms:CAS_79805-24-6 | NSC_16219643 | beta-Casomorphin
TypeSmall organic molecule
Emp. Form.C28H35N5O5
Mol. Mass.521.608
SMILESNC(Cc1ccc(O)cc1)C(=O)N1CCCC1C(=O)NC(Cc1ccccc1)C(=O)N1CCCC1C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: