Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinergic, muscarinic
LigandBDBM50018550
Substrate/Competitorn/a
Ki 3.8±n/a nM
CommentsPDSP_642
Citation Bloom JWHalonen MLawrence LJRould ESeaver NAYamamura HI Characterization of high affinity [3H]pirenzepine and (-)-[3H] quinuclidinyl benzilate binding to muscarinic cholinergic receptors in rabbit peripheral lung. J Pharmacol Exp Ther 240:51-8 (1987) [PubMed]
More Info.:Get all data from this article
 
Cholinergic, muscarinic
Name:Cholinergic, muscarinic
Synonyms:Beta-arrestin-1 | OPIATE Delta | PAF Platelet activating factor
Type:Enzyme Catalytic Domain
Mol. Mass.:46360.54
Organism:RABBIT
Description:Cholinergic, muscarinic 0 RABBIT::Q95223
Residue:410
Sequence:
MGDKGTRVFKKASPNGKLTVYLGKRGFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PKLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
HPTAETTRLFLMSDKPLHLEASLDKEIYYHGEPIIVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLMREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKEEPPHREVPEN
ETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEDDVTGSPRLNDR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50018550
n/a
NameBDBM50018550
Synonyms:1'-Benzyl-3-phenyl-[3,4']bipiperidinyl-2,6-dione | CHEMBL273974 | Dexetimide | Levetimide
TypeSmall organic molecule
Emp. Form.C23H26N2O2
Mol. Mass.362.4647
SMILESO=C1CC[C@](C2CCN(Cc3ccccc3)CC2)(C(=O)N1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: