Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2C8
LigandBDBM106203
Substrate/Competitorn/a
Meas. Tech.CYP Enzyme Inhibition Assay
pH7.4±n/a
Temperature310.15±n/a K
IC50>30000±0.0 nM
Commentsextracted
Citation Li YPrakash SRXia CQLiao MM Inhibitor of breast cancer resistance protein (BCRP) US Patent  US9695174 Publication Date 7/4/2017
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2C8
Name:Cytochrome P450 2C8
Synonyms:CYPIIC8 | Cytochrome P450 2C8 (CYP2C8) | P450 IIC2 | P450 MP-12/MP-20 | P450 form 1 | S-mephenytoin 4-hydroxylase
Type:Protein
Mol. Mass.:55839.23
Organism:Homo sapiens (Human)
Description:P10632
Residue:490
Sequence:
MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKV
YGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRW
KEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALT
RSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSD
LVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP
PSYQICFIPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM106203
n/a
NameBDBM106203
Synonyms:US9695174, I-1
TypeSmall organic molecule
Emp. Form.C20H25N3O3
Mol. Mass.355.4308
SMILESCOc1ccc2c3C[C@@H]4N([C@@H](CC(C)C)c3[nH]c2c1)C(=O)[C@H](C)NC4=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: