Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 receptor
LigandBDBM22888
Substrate/Competitorn/a
Ki 3000±n/a nM
CommentsPDSP_445
Citation Gajtkowski GANorris DBRising TJWood TP Specific binding of 3H-tiotidine to histamine H2 receptors in guinea pig cerebral cortex. Nature 304:65-7 (1983) [PubMed]
More Info.:Get all data from this article
 
Histamine H2 receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2 | Histamine H2-Gs alpha S
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40567.22
Organism:Cavia porcellus (domestic guinea pig)
Description:For the H2 receptor-binding assays, guinea pig striatum was used.
Residue:359
Sequence:
MAFNGTVPSFCMDFTVYKVTISVILIILILVTVAGNVVVCLAVGLNRRLRSLTNCFIVSL
AVTDLLLGLLVLPFSAIYQLSCKWSFSKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLITPARVAISLVFIWVISITLSFLSIHLGWNSRNETSKDNDTIVKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYFRIFKIAREQARRINHIGSWKAATIREHKATVTLAAVM
GAFIICWFPYFTVFVYRGLKGDDAVNEVFEDVVLWLGYANSALNPILYAALNRDFRTAYH
QLFCCRLASHNSHETSLRLNNSQLNRSQCQEPRWQEDKPLNLQVWSGTEVTAPQGATNR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22888
n/a
NameBDBM22888
Synonyms:1-[4-(1H-imidazol-5-yl)butyl]-3-methylthiourea | Burimamide | CHEMBL12160
TypeSmall organic molecule
Emp. Form.C9H16N4S
Mol. Mass.212.315
SMILESCNC(=S)NCCCCc1cnc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: