| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM82090 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 2.15±n/a nM |
|---|
| Comments | PDSP_2915 |
|---|
| Citation |  Leslie, FM; Chavkin, C; Cox, BM Opioid binding properties of brain and peripheral tissues: evidence for heterogeneity in opioid ligand binding sites. J Pharmacol Exp Ther214:395-402 (1980) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Delta opioid receptor | Delta-type opioid receptor | OPIATE Delta | OPRD1 | OPRD_PIG |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25736.90 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | OPIATE Delta OPRD1 GUINEA PIG::P79291 |
|---|
| Residue: | 228 |
|---|
| Sequence: | GIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNM
FTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPR
DGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILVITVCYGLMLLRLRSVRLLSGSKEK
DRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
|
|
|
|---|
| BDBM82090 |
|---|
| n/a |
|---|
| Name | BDBM82090 |
|---|
| Synonyms: | DALLE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H39N5O7 |
|---|
| Mol. Mass. | 569.6493 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
