Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 13 (CA XIII)
LigandBDBM10888
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.5±0
Temperature293.15±0 K
Ki 430±0.0 nM
Citation De Simone GScozzafava ASupuran CT Which carbonic anhydrases are targeted by the antiepileptic sulfonamides and sulfamates? Chem Biol Drug Des 74:317-21 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic anhydrase 13 (CA XIII)
Name:Carbonic anhydrase 13 (CA XIII)
Synonyms:Carbonic anhydrase XIII (CA XIII)
Type:Enzyme
Mol. Mass.:29445.78
Organism:Homo sapiens (Human)
Description:Q8N1Q1
Residue:262
Sequence:
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNF
DLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA
FLVSNHRPPQPLKGRKVRASFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10888
n/a
NameBDBM10888
Synonyms:1,2-benzoxazol-3-ylmethanesulfonamide | CHEMBL750 | SPR_2 | US10172837, Zonisamide | Zonisamide | Zonisamide (ZNA) | Zonisamide (ZNS) | Zonisamide, 1 | Zonisamide, ZNS
TypeSmall organic molecule
Emp. Form.C8H8N2O3S
Mol. Mass.212.226
SMILESNS(=O)(=O)Cc1noc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: