| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 5A, mitochondrial |
|---|
| Ligand | BDBM26999 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| pH | 7.5±0 |
|---|
| Temperature | 293.15±0 K |
|---|
| Ki | 81±0.0 nM |
|---|
| Citation |  De Simone, G; Scozzafava, A; Supuran, CT Which carbonic anhydrases are targeted by the antiepileptic sulfonamides and sulfamates? Chem Biol Drug Des74:317-21 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Carbonic anhydrase 5A, mitochondrial |
|---|
| Name: | Carbonic anhydrase 5A, mitochondrial |
|---|
| Synonyms: | CA-VA | CA5 | CA5A | CAH5A_HUMAN | Carbonate dehydratase VA | Carbonic Anhydrase VA | Carbonic anhydrase 5A (CA VA) | Carbonic anhydrase 5A, mitochondrial | Carbonic anhydrase 5A, mitochondrial precursor | Carbonic anhydrase V | Carbonic anhydrase VA (CA VA) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34755.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human (cloned) isozyme |
|---|
| Residue: | 305 |
|---|
| Sequence: | MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
|
|
|
|---|
| BDBM26999 |
|---|
| n/a |
|---|
| Name | BDBM26999 |
|---|
| Synonyms: | 4-(1,1-dioxo-1,2-thiazinan-2-yl)benzene-1-sulfonamide | CHEMBL328560 | Contravul | Ospolot | Sulthiame (SLT) | Sulthiame, 2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H14N2O4S2 |
|---|
| Mol. Mass. | 290.359 |
|---|
| SMILES | NS(=O)(=O)c1ccc(cc1)N1CCCCS1(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
