Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase 5A, mitochondrial |
---|
Ligand | BDBM82104 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Assay |
---|
pH | 7.5±0 |
---|
Temperature | 293.15±0 K |
---|
Ki | 135±0.0 nM |
---|
Citation | De Simone, G; Scozzafava, A; Supuran, CT Which carbonic anhydrases are targeted by the antiepileptic sulfonamides and sulfamates? Chem Biol Drug Des74:317-21 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Carbonic anhydrase 5A, mitochondrial |
---|
Name: | Carbonic anhydrase 5A, mitochondrial |
Synonyms: | CA-VA | CA5 | CA5A | CAH5A_HUMAN | Carbonate dehydratase VA | Carbonic Anhydrase VA | Carbonic anhydrase 5A (CA VA) | Carbonic anhydrase 5A, mitochondrial | Carbonic anhydrase 5A, mitochondrial precursor | Carbonic anhydrase V | Carbonic anhydrase VA (CA VA) |
Type: | Enzyme |
Mol. Mass.: | 34755.54 |
Organism: | Homo sapiens (Human) |
Description: | Human (cloned) isozyme |
Residue: | 305 |
Sequence: | MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
|
|
|
BDBM82104 |
---|
n/a |
---|
Name | BDBM82104 |
Synonyms: | Investigational agent, 5 |
Type | Small organic molecule |
Emp. Form. | C13H19N5O3S2 |
Mol. Mass. | 357.452 |
SMILES | NS(=O)(=O)c1nnc(NC(=O)N[C@]23C[C@H]4C[C@H](C[C@H](C4)C2)C3)s1 |r,THB:13:14:20.12.21:17,15:14:20:16.21.17| |
Structure |
|