| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM82110 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| IC50 | 14.9±0.0 nM |
|---|
| Citation |  Ma, X; Woon, RS; Ho, PC; Chui, WK Antiproliferative activity against MCF-7 breast cancer cells by diamino-triazaspirodiene antifolates. Chem Biol Drug Des74:322-6 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DHFR | DYR_BOVIN | Dihydrofolate reductase | Dihydrofolate reductase (DHFR) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21603.71 |
|---|
| Organism: | Bos taurus (Cattle) |
|---|
| Description: | P00376 |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
|
|
|
|---|
| BDBM82110 |
|---|
| n/a |
|---|
| Name | BDBM82110 |
|---|
| Synonyms: | 6,8,10-Traiazaspiro[4.5]deca-6,8-diene-7,9-diamine, If |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H26N6O |
|---|
| Mol. Mass. | 330.4279 |
|---|
| SMILES | CN(CCCON1C(N)=NC(N)=NC11CCCC1)c1ccccc1 |c:8,11| |
|---|
| Structure | 
|
|---|
Search and Browse
