Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPTGIR
LigandBDBM50101828
Substrate/Competitorn/a
Ki 137±n/a nM
CommentsPDSP_1459
Citation MacDermot JBlair IACresp TM Prostacyclin receptors of a neuronal hybrid cell line. Divalent citations and ligand-receptor coupling. Biochem Pharmacol 30:2041-4 (1981) [PubMed]  Article
More Info.:Get all data from this article
 
PTGIR
Name:PTGIR
Synonyms:Prostacyclin receptor | Prostaglandin I | Prostaglandin I2
Type:Enzyme Catalytic Domain
Mol. Mass.:44475.65
Organism:MOUSE
Description:Prostaglandin I2 PTGIR MOUSE::P43252
Residue:415
Sequence:
MMASDGHPGPPSVTPGSPLSAGGREWQGMAGSCWNITYVQDSVGPATSTLMFVAGVVGNG
LALGILGARRRSHPSAFAVLVTGLAVTDLLGTCFLSPAVFVAYARNSSLLGLAHGGTMLC
DTFAFAMTFFGLASTLILFAMAVERCLALSHPYLYAQLDGPRCARFALPSIYAFCCLFCS
LPLLGLGEHQQYCPGSWCFIRMRSAQPGGCAFSLAYASLMALLVTSIFFCNGSVTLSLYH
MYRQQRRHHGSFVPTSRAREDEVYHLILLALMTVIMAVCSLPLMIRGFTQAIAPDSREMG
DLLAFRFNAFNPILDPWVFILFRKAVFQRLKFWLCCLCARSVHGDLQAPLSRPASGRRDP
PAPTSLQAKEGSWVPLSSWGTGQVAPLTAVPLTGGDGCSVGMPSKSEAIAACSLC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50101828
n/a
NameBDBM50101828
Synonyms:7-[(1R,2R,3R)-3-Hydroxy-2-((E)-(R)-3-hydroxy-oct-1-enyl)-5-oxo-cyclopentyl]-heptanoic acid | CHEMBL62570 | PGE1 | US9180116, PGE1
TypeSmall organic molecule
Emp. Form.C20H34O5
Mol. Mass.354.481
SMILESCCCCC[C@@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1CCCCCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: