Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPTGIR
LigandBDBM82096
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_5311
Citation MacDermot JBlair IACresp TM Prostacyclin receptors of a neuronal hybrid cell line. Divalent citations and ligand-receptor coupling. Biochem Pharmacol 30:2041-4 (1981) [PubMed]  Article
More Info.:Get all data from this article
 
PTGIR
Name:PTGIR
Synonyms:Prostacyclin receptor | Prostaglandin I | Prostaglandin I2
Type:Enzyme Catalytic Domain
Mol. Mass.:44475.65
Organism:MOUSE
Description:Prostaglandin I2 PTGIR MOUSE::P43252
Residue:415
Sequence:
MMASDGHPGPPSVTPGSPLSAGGREWQGMAGSCWNITYVQDSVGPATSTLMFVAGVVGNG
LALGILGARRRSHPSAFAVLVTGLAVTDLLGTCFLSPAVFVAYARNSSLLGLAHGGTMLC
DTFAFAMTFFGLASTLILFAMAVERCLALSHPYLYAQLDGPRCARFALPSIYAFCCLFCS
LPLLGLGEHQQYCPGSWCFIRMRSAQPGGCAFSLAYASLMALLVTSIFFCNGSVTLSLYH
MYRQQRRHHGSFVPTSRAREDEVYHLILLALMTVIMAVCSLPLMIRGFTQAIAPDSREMG
DLLAFRFNAFNPILDPWVFILFRKAVFQRLKFWLCCLCARSVHGDLQAPLSRPASGRRDP
PAPTSLQAKEGSWVPLSSWGTGQVAPLTAVPLTGGDGCSVGMPSKSEAIAACSLC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82096
n/a
NameBDBM82096
Synonyms:2,3-dinor-6-ketoprostaglandin F1alpha | CAS_64700-71-6 | PGF1alpha, 6-oxo
TypeSmall organic molecule
Emp. Form.C18H30O6
Mol. Mass.342.4272
SMILESCCCCC[C@H](O)\C=C\[C@H]1[C@H](O)C[C@H](O)[C@@H]1CC(=O)CCC(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: