Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTBXA2R
LigandBDBM50020300
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_1467
Citation Armstrong RAJones RLWilson NH Ligand binding to thromboxane receptors on human platelets: correlation with biological activity. Br J Pharmacol 79:953-64 (1983) [PubMed]  Article
More Info.:Get all data from this article
 
TBXA2R
Name:TBXA2R
Synonyms:Thromboxane A2
Type:Enzyme Catalytic Domain
Mol. Mass.:37114.77
Organism:MOUSE
Description:Thromboxane A2 TBXA2R MOUSE::P30987
Residue:341
Sequence:
MWPNGTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRS
SFLALLCGLVLTDFLGLLVTGAIVASQHAALLDWRATDPSCRLCYFMGVAMVFFGLCPLL
LGAAMASERFVGITRPFSRPTATSRRAWATVGLVWVAAGALGLLPLLGLGRYSVQYPGSW
CFLTLGTQRGDVVFGLIFALLGSASVGLSLLLNTVSVATLCRVYHTREATQRPRDCEVEM
MVQLVGIMVVATVCWMPLLVFIMQTLLQTPPVMSFSGQLLRATEHQLLIYLRVATWNQIL
DPWVYILFRRSVLRRLHPRFSSQLQAVSLRRPPAQAMLSGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50020300
n/a
NameBDBM50020300
Synonyms:(S-isomer)7-[3,5-Dihydroxy-2-(3-hydroxy-oct-1-enyl)-cyclopentyl]-hept-5-enoic acid | (Z)-7-[(1R,3R,5S)-3,5-Dihydroxy-2-((E)-(S)-3-hydroxy-oct-1-enyl)-cyclopentyl]-hept-5-enoic acid | 7-[3,5-Dihydroxy-2-(3-hydroxy-oct-1-enyl)-cyclopentyl]-hept-5-enoic acid | CHEMBL12114 | PGF2Alpha | Prostaglandin F2alpha7-[3,5-Dihydroxy-2-(3-hydroxy-oct-1-enyl)-cyclopentyl]-hept-5-enoic acid
TypeSmall organic molecule
Emp. Form.C20H34O5
Mol. Mass.354.481
SMILESCCCCC[C@H](O)\C=C\C1[C@H](O)C[C@H](O)[C@@H]1C\C=C/CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: