Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin
LigandBDBM31995
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_2668
Citation Van Dijk ARichards JGTrzeciak AGillessen DMöhler H Cholecystokinin receptors: biochemical demonstration and autoradiographical localization in rat brain and pancreas using [3H] cholecystokinin8 as radioligand. J Neurosci 4:1021-33 (1984) [PubMed]
More Info.:Get all data from this article
 
Cholecystokinin
Name:Cholecystokinin
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:12844.29
Organism:RAT
Description:Cholecystokinin 0 RAT::P01355
Residue:115
Sequence:
MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGA
LLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFGRRSAEDYEYPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31995
n/a
NameBDBM31995
Synonyms:ADP | Adenosine Diphosphate (ADP) | CHEMBL14830
TypeNucleoside or nucleotide
Emp. Form.C10H15N5O10P2
Mol. Mass.427.2011
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: